PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021871
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 224aa    MW: 25067.1 Da    PI: 6.7869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021871genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+ +++ +G  +W++ ++   + R++k+c++rw +yl
      Lus10021871 14 RGPWTPEEDHILISYIRNHGHTNWRALPKLARLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding48.81.7e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
      Lus10021871  67 RGNFTAHEEDSIIHLHQLLGNK-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.037961IPR017930Myb domain
SuperFamilySSF466893.3E-2910108IPR009057Homeodomain-like
SMARTSM007171.9E-111363IPR001005SANT/Myb domain
PfamPF002491.2E-151461IPR001005SANT/Myb domain
CDDcd001672.64E-91661No hitNo description
PROSITE profilePS5129422.73562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1266114IPR001005SANT/Myb domain
PfamPF002491.1E-1367112IPR001005SANT/Myb domain
CDDcd001677.89E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGRAPCCAKM GLKRGPWTPE EDHILISYIR NHGHTNWRAL PKLARLLRCG KSCRLRWINY  60
LNPDIKRGNF TAHEEDSIIH LHQLLGNKWS AIAAKLPGRT DNEIKNVWHT HLKKRLNLTT  120
KNSPETETQS SSLTGNSLSS PETSSCAELP SSSFSHIDES LWSGSGELTG GEYWQFDTQF  180
SRESDLTELD GVGETNGVVD DSMVFWYDLL VQAGRNESIL TVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091315.12e-78PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-72MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A060CYS62e-77A0A060CYS6_MAIZE; MYB transcription factor (Fragment)
TrEMBLA0A078HDN83e-77A0A078HDN8_BRANA; BnaA01g23930D protein
STRINGGRMZM2G095904_P017e-77(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-76myb domain protein 15